PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G097100.1
Common NameB456_009G097100, LOC105768867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 372aa    MW: 40162.9 Da    PI: 5.2103
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G097100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.48.7e-30169222155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         ++rl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Gorai.009G097100.1 169 RQRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 222
                         58*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-19166226IPR009057Homeodomain-like
PROSITE profilePS5129411.24166225IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-29168227IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23170222IPR006447Myb domain, plants
PfamPF002496.9E-8172221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGGEVKIGVF EANGRDDEAI ATATDAVVDE EDDVNERVLE WEMGLPNCDD LTPLSQLLVP  60
PELASAFSIS PEPRRTALDV NRASQDTLSS LRSTGAHSST TNNNNNNNNN NNFRSFDDPM  120
VVEPEGDGSG SGSGSDPKKM RMMEIAEEAD SAVRTAENSD DPSGKTVKRQ RLVWTPQLHK  180
RFVDVVAHLG IKNAVPKTIM QLMNVEGLTR ENVASHLQKY RLYLKRMQGL SNEGPSASDQ  240
LFASTPVPQS MHANGAGVGG GGGIGVGGGS VNSNGHVGMT LPMLYGASMI PMPMPMYGPV  300
HQGGNHHPQN GYEANSYGMM QQRDWSGGNK YGFLFDHTGG KTINVPCILV NVRRSFLLLF  360
FLSFLCFQNF D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-19168227463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6150170.0JX615017.1 Gossypium hirsutum clone NBRI_GE58778 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444547.10.0PREDICTED: transcription factor PCL1 isoform X1
SwissprotQ9SNB44e-81PCL1_ARATH; Transcription factor LUX
TrEMBLA0A0D2UJ100.0A0A0D2UJ10_G
STRINGVIT_06s0004g05120.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.23e-75G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]